- Recombinant Bacillus subtilis Sensor histidine kinase ykoH (ykoH)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1175431
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 50,651 Da
- E Coli or Yeast
- 34-153
- Sensor histidine kinase ykoH (ykoH)
Sequence
LTSKDAARLADETDNIAEALRAAETEGVALQDMLQAYLPANGMVRVVNGDQKAVMTITKEKAYKDFPLSFHSGETADVRKPDGKLFAEAAVPVIWTDGQVVSLQLVERLENTEESLFLLK